DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and CDSP32

DIOPT Version :10

Sequence 1:NP_511046.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_177735.1 Gene:CDSP32 / 843940 AraportID:AT1G76080 Length:302 Species:Arabidopsis thaliana


Alignment Length:94 Identity:30/94 - (31%)
Similarity:46/94 - (48%) Gaps:5/94 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYHKRIE--AADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYK- 70
            |..|.|:  ....||||||.....||||.::..||..|:|..|...|..:::.|:.:...|..| 
plant   195 DVEKLIDENRTGGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKD 259

  Fly    71 --VRSMPTFVFLRQNRRLASFAGADEHKL 97
              |..:|||:|:|.......:.|:.:.:|
plant   260 MNVIEVPTFLFIRDGEIRGRYVGSGKGEL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_511046.1 CnoX 6..105 CDD:442352 30/94 (32%)
CDSP32NP_177735.1 TRX_CDSP32 79..181 CDD:239283
TRX_CDSP32 194..296 CDD:239283 30/94 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.