DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TTL1

DIOPT Version :10

Sequence 1:NP_511046.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_175737.1 Gene:TTL1 / 841764 AraportID:AT1G53300 Length:699 Species:Arabidopsis thaliana


Alignment Length:53 Identity:17/53 - (32%)
Similarity:26/53 - (49%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRRL 86
            ||::...|.||..:|.| ...||:|:||...:.....||.:||....:...|:
plant   628 CKQISPFVDSLCTRYPS-IHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRV 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_511046.1 CnoX 6..105 CDD:442352 17/53 (32%)
TTL1NP_175737.1 LapB 238..562 CDD:442196
TPR repeat 260..290 CDD:276809
TPR repeat 295..318 CDD:276809
TPR 418..>582 CDD:440225
TPR repeat 419..447 CDD:276809
TPR repeat 469..493 CDD:276809
TPR repeat 498..528 CDD:276809
TPR repeat 533..561 CDD:276809
TRX_family 604..691 CDD:239245 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.