DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and ACHT2

DIOPT Version :10

Sequence 1:NP_511046.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_849469.1 Gene:ACHT2 / 829088 AraportID:AT4G29670 Length:236 Species:Arabidopsis thaliana


Alignment Length:108 Identity:27/108 - (25%)
Similarity:56/108 - (51%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEEL 65
            |..:.:..::...:..|.::|::::||.|||..|:.:...:...|.::.. .|.||::.|:.:.:
plant   105 MVDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPD-IVFLKVNFDENKPM 168

  Fly    66 TERYKVRSMPTFVFLR-QNRRLASFAGADEHKLTNMMAKLVKA 107
            .:...||.:|.|.|.| .:.:|.||:.:        :||:.||
plant   169 CKSLNVRVLPFFHFYRGADGQLESFSCS--------LAKVKKA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_511046.1 CnoX 6..105 CDD:442352 24/99 (24%)
ACHT2NP_849469.1 TRX_family 112..213 CDD:239245 26/101 (26%)

Return to query results.
Submit another query.