DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and png-1

DIOPT Version :10

Sequence 1:NP_511046.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_492913.1 Gene:png-1 / 173028 WormBaseID:WBGene00010160 Length:606 Species:Caenorhabditis elegans


Alignment Length:97 Identity:29/97 - (29%)
Similarity:61/97 - (62%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEEL 65
            :.|:..:|:..:|.:|  ::||::||:|.|||||:.:....:..:.:|.: |..||::.|...::
 Worm     6 VGSLPELNNILERSDA--NRLIIIDFFANWCGPCRMISPIFEQFSAEYGN-ATFLKVNCDVARDI 67

  Fly    66 TERYKVRSMPTFVFLRQNRRLASFAGADEHKL 97
            .:||.:.:||||:||:..:::....||::..:
 Worm    68 VQRYNISAMPTFIFLKNRQQVDMVRGANQQAI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_511046.1 CnoX 6..105 CDD:442352 28/92 (30%)
png-1NP_492913.1 TRX_family 20..103 CDD:239245 26/83 (31%)
Transglut_core 217..296 CDD:376628
PAW 407..604 CDD:471983
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.