DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and txl-1

DIOPT Version :10

Sequence 1:NP_511046.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_491127.1 Gene:txl-1 / 171897 WormBaseID:WBGene00021826 Length:284 Species:Caenorhabditis elegans


Alignment Length:101 Identity:36/101 - (35%)
Similarity:57/101 - (56%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTE 67
            :|:...|:..::..|..|.:::||.|.||||||.:..|.::|:.:|.. ||.||:||:..|:.:.
 Worm     5 NVKDDEDFRNQLSLAGLKSVIVDFTAVWCGPCKMIAPTFEALSNQYLG-AVFLKVDVEICEKTSS 68

  Fly    68 RYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAK 103
            ...|.|||||:..:...|:....|||...|..|:.|
 Worm    69 ENGVNSMPTFMVFQSGVRVEQMKGADAKALETMVKK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_511046.1 CnoX 6..105 CDD:442352 35/98 (36%)
txl-1NP_491127.1 TRX_family 10..103 CDD:239245 34/93 (37%)
PITH 121..262 CDD:461848
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.