DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and trxC

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_417077.1 Gene:trxC / 947062 ECOCYCID:EG11887 Length:139 Species:Escherichia coli


Alignment Length:84 Identity:31/84 - (36%)
Similarity:54/84 - (64%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVN 73
            :.||:  :|.:|..|||||:|.|||||:..||..:::||:.|.:|..:|||.:...:::..:.:.
E. coli    43 ETLDK--LLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNTEAERELSSRFGIR 105

  Fly    74 SMPTFVFIKGGNVLELFVG 92
            |:||.:..|.|.|:::..|
E. coli   106 SIPTIMIFKNGQVVDMLNG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 29/79 (37%)
trxCNP_417077.1 PRK10996 1..139 CDD:182889 31/84 (37%)

Return to query results.
Submit another query.