DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRX3

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_010006.1 Gene:TRX3 / 850444 SGDID:S000000679 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:88 Identity:43/88 - (48%)
Similarity:54/88 - (61%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPT 77
            :.||...||| ||||||.||||||::.|.|.:|.|.|.| |..:|.:|||:.||..|..|.:|||
Yeast    37 RNLIKQNDKL-VIDFYATWCGPCKMMQPHLTKLIQAYPD-VRFVKCDVDESPDIAKECEVTAMPT 99

  Fly    78 FVFIKGGNVLELFVGCNSDKLAK 100
            ||..|.|.::...:|.|...|.|
Yeast   100 FVLGKDGQLIGKIIGANPTALEK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 43/87 (49%)
TRX3NP_010006.1 TRX_family 35..125 CDD:239245 43/88 (49%)

Return to query results.
Submit another query.