DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and THM1

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_849585.1 Gene:THM1 / 839436 AraportID:AT1G03680 Length:179 Species:Arabidopsis thaliana


Alignment Length:102 Identity:39/102 - (38%)
Similarity:58/102 - (56%) Gaps:2/102 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITV 68
            ||.|....| .|:|..|:.|.:||:|.||||||:|.|.::||||:|:.:....|:|.||:.....
plant    77 PVVNDSTWD-SLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATPG 140

  Fly    69 EYNVNSMPTFVFIKGGNVLELFVGC-NSDKLAKLMEK 104
            :|.|.|:||.:....|...:..:|. :.|.||..:.|
plant   141 QYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLATSINK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 35/92 (38%)
THM1NP_849585.1 CnoX 79..179 CDD:442352 37/100 (37%)

Return to query results.
Submit another query.