DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and ATTRX4

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_173403.1 Gene:ATTRX4 / 838562 AraportID:AT1G19730 Length:119 Species:Arabidopsis thaliana


Alignment Length:91 Identity:42/91 - (46%)
Similarity:61/91 - (67%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGG 84
            :||:||||.|.||.||::|||..::||:::....:..||:|||.:.:..|:.|.:||||||||.|
plant    28 NKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPTFVFIKAG 92

  Fly    85 NVLELFVGCNSDKLAKLMEKHAGVYT 110
            .|::..||.|.:.|...:.||.||.|
plant    93 EVVDKLVGANKEDLQAKIVKHTGVTT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 38/85 (45%)
ATTRX4NP_173403.1 TRX_family 20..110 CDD:239245 37/81 (46%)

Return to query results.
Submit another query.