DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and CXXS1

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_172620.1 Gene:CXXS1 / 837696 AraportID:AT1G11530 Length:118 Species:Arabidopsis thaliana


Alignment Length:81 Identity:29/81 - (35%)
Similarity:49/81 - (60%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGGNVL 87
            :|..|.|.||.|...:....:|||..|.|.:.:: |:|||.:::..:..|.:||||:|:|.||.:
plant    27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLI-VDVDEVKEVASQLEVKAMPTFLFLKDGNAM 90

  Fly    88 ELFVGCNSDKLAKLME 103
            :..||.|.|::.|.::
plant    91 DKLVGANPDEIKKRVD 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 29/81 (36%)
CXXS1NP_172620.1 TRX_family 11..106 CDD:239245 29/79 (37%)

Return to query results.
Submit another query.