DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and ACHT4

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_172333.1 Gene:ACHT4 / 837379 AraportID:AT1G08570 Length:275 Species:Arabidopsis thaliana


Alignment Length:104 Identity:32/104 - (30%)
Similarity:53/104 - (50%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVE 69
            :.:..:|...|..|.|||||:||::..||.||.:.||:.:.|:...| |..|:||.:|::.:...
plant   102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQFAEMNPD-VQFLQVNYEEHKSMCYS 165

  Fly    70 YNVNSMPTFVFIKGGNVLELFVGCNSDKLAKL---MEKH 105
            ..|:.:|.|.|.:|.........|.:..:.|.   :.||
plant   166 LGVHVLPFFRFYRGSQGRVCSFSCTNATIKKFRDALAKH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 31/95 (33%)
ACHT4NP_172333.1 TRX_family 115..202 CDD:239245 28/87 (32%)

Return to query results.
Submit another query.