DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and WCRKC1

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001031844.1 Gene:WCRKC1 / 830558 AraportID:AT5G06690 Length:214 Species:Arabidopsis thaliana


Alignment Length:112 Identity:29/112 - (25%)
Similarity:52/112 - (46%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVRNKDDLDQQLILAE--DKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDI 66
            |:.|.::||..|..|.  .:.::|::.|.||..|..:.|||::||.:|::|.....|        
plant   100 PINNVEELDAVLSHARQLSQPIIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYV-------- 156

  Fly    67 TVEYNVNSMPTFVFIKGGNV----LELFVGCNSDKLAKLMEKHAGVY 109
                :||.:|. ..:|.||:    |.:.:...||.:....|....::
plant   157 ----DVNKVPQ-TLVKRGNISVKCLNIILSFFSDVVCAKSEPITSIF 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 25/97 (26%)
WCRKC1NP_001031844.1 TRX_family 105..>164 CDD:239245 20/71 (28%)

Return to query results.
Submit another query.