DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and ATHM2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_192261.1 Gene:ATHM2 / 825653 AraportID:AT4G03520 Length:186 Species:Arabidopsis thaliana


Alignment Length:84 Identity:32/84 - (38%)
Similarity:50/84 - (59%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVN 73
            |.....|:|.....||:||:|.||||||:|.|.:::|||.|:.::...|:|.||:.:...:|.|.
plant    87 DSTWDSLVLKATGPVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVR 151

  Fly    74 SMPTFVFIKGGNVLELFVG 92
            |:||.:...||...:..:|
plant   152 SIPTIMIFVGGEKKDTIIG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 31/79 (39%)
ATHM2NP_192261.1 CnoX 82..185 CDD:442352 32/84 (38%)

Return to query results.
Submit another query.