DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRXF1

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_186922.1 Gene:TRXF1 / 821260 AraportID:AT3G02730 Length:178 Species:Arabidopsis thaliana


Alignment Length:87 Identity:35/87 - (40%)
Similarity:52/87 - (59%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVD-ENEDITVEYNVNSMPTFVFI 81
            |.:||||:|.|..||||||:||||...|:::|.| ||.||::.: :|..:..|..:..:|||..:
plant    85 AGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDD-VVFLKLDCNPDNRPLAKELGIRVVPTFKIL 148

  Fly    82 KGGNVLELFVGCNSDKLAKLME 103
            |...|::...|...|.|...:|
plant   149 KDNKVVKEVTGAKYDDLVAAIE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 35/87 (40%)
TRXF1NP_186922.1 TRX_family 76..170 CDD:239245 34/85 (40%)

Return to query results.
Submit another query.