DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRX-M4

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_188155.1 Gene:TRX-M4 / 820775 AraportID:AT3G15360 Length:193 Species:Arabidopsis thaliana


Alignment Length:102 Identity:34/102 - (33%)
Similarity:59/102 - (57%) Gaps:2/102 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLD-QQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITV 68
            |.|..|.: |..:|..|..|:::|:|.|||||::|.|.:|:||:.::.:....|:|.||:.:...
plant    88 VPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTAN 152

  Fly    69 EYNVNSMPTFVFIKGGNVLELFVGC-NSDKLAKLMEK 104
            .|.:.|:||.:..|||...:..:|. ..:.|.|.:|:
plant   153 RYGIRSVPTVIIFKGGEKKDSIIGAVPRETLEKTIER 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 30/92 (33%)
TRX-M4NP_188155.1 CnoX 90..191 CDD:442352 33/100 (33%)

Return to query results.
Submit another query.