DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and CXXS2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_181611.2 Gene:CXXS2 / 818676 AraportID:AT2G40790 Length:154 Species:Arabidopsis thaliana


Alignment Length:101 Identity:34/101 - (33%)
Similarity:60/101 - (59%) Gaps:3/101 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYPVRNKDDLDQQLILAED--KLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENE 64
            |:||...:..::::..|..  |::|::|.|.||.|.|.|.|...|||..|:..:.| .::|:|..
plant    42 VHPVSRMEKWEEKITEANSHGKILVVNFKASWCLPSKTILPIYQELASTYTSMIFV-TIDVEELA 105

  Fly    65 DITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAK 100
            :.:.|:||::.||.||:|.|..::..||.::.:|.|
plant   106 EFSHEWNVDATPTVVFLKDGRQMDKLVGGDAAELQK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 31/89 (35%)
CXXS2NP_181611.2 TRX_family 49..138 CDD:239245 29/89 (33%)

Return to query results.
Submit another query.