DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and ATHM3

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001154520.1 Gene:ATHM3 / 816050 AraportID:AT2G15570 Length:174 Species:Arabidopsis thaliana


Alignment Length:77 Identity:22/77 - (28%)
Similarity:43/77 - (55%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVF 80
            :|..:..|:::||..|||||:::...:||:|..|:.::....:|.|.:..:..||.:.::|..:.
plant    81 VLKSETPVLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLL 145

  Fly    81 IKGGNVLELFVG 92
            .|.|...|..:|
plant   146 FKNGEKRESIMG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 22/77 (29%)
ATHM3NP_001154520.1 CnoX 71..172 CDD:442352 22/77 (29%)

Return to query results.
Submit another query.