DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txndc8

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_080408.3 Gene:Txndc8 / 67402 MGIID:1914652 Length:127 Species:Mus musculus


Alignment Length:82 Identity:29/82 - (35%)
Similarity:49/82 - (59%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            ||..::|..:|.:....|.:||||::|.|.||||||.|||....::.:|.: |...:|:||.:::
Mouse     1 MVKRIKNMSELKELFSDAGNKLVVVEFSAKWCGPCKTIAPVFQAMSLKYQN-VTFAQVDVDSSKE 64

  Fly    66 ITVEYNVNSMPTFVFIK 82
            :....::..:|||...|
Mouse    65 LAEHCDITMLPTFQMFK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 25/69 (36%)
Txndc8NP_080408.3 TRX_family 9..>81 CDD:239245 25/72 (35%)

Return to query results.
Submit another query.