DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and txnb

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001002461.1 Gene:txnb / 436734 ZFINID:ZDB-GENE-040718-162 Length:107 Species:Danio rerio


Alignment Length:106 Identity:43/106 - (40%)
Similarity:62/106 - (58%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDR-VVVLKVNVDENE 64
            ||..:.:|...|..|..|.|||||:||.|.|||||:.|.|....|:::..:: ||.|||:||:.:
Zfish     1 MVLEIEDKAAFDNALKNAGDKLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKVDVDDAQ 65

  Fly    65 DITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKH 105
            |:.....::.||||.|.|.|..::.|.|.|..||.:.:..|
Zfish    66 DVAALCGISCMPTFHFYKNGKKVDEFSGSNQSKLEEKINSH 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 39/93 (42%)
txnbNP_001002461.1 TRX_family 9..104 CDD:239245 39/94 (41%)

Return to query results.
Submit another query.