DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txndc2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001139476.1 Gene:Txndc2 / 316777 RGDID:1359251 Length:550 Species:Rattus norvegicus


Alignment Length:100 Identity:34/100 - (34%)
Similarity:58/100 - (57%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            ||..:::|::.::.|..|.:|||.:||.|.|||||:.:.|....|:.::.| |:.|:|:.::.|.
  Rat   446 MVRVIKDKEEFEEVLKDAGEKLVAVDFSAPWCGPCRKMRPHFHSLSLKHED-VIFLEVDTEDCEQ 509

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAK 100
            :..:..|..:|||.|.|....:..|.|...:||.|
  Rat   510 LVQDCEVFHLPTFQFYKNEEKVGEFSGALVEKLEK 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 30/86 (35%)
Txndc2NP_001139476.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..428
22 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I 104..440
PTZ00121 <151..466 CDD:173412 5/19 (26%)
TRX_family 454..547 CDD:239245 30/91 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.