DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and LOC100497910

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_031746215.1 Gene:LOC100497910 / 100497910 XenbaseID:XB-GENE-29083927 Length:112 Species:Xenopus tropicalis


Alignment Length:100 Identity:33/100 - (33%)
Similarity:52/100 - (52%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVE 69
            |.:.|:|...|..|.:|||::...:..||.||:..|.|:.|..:..| ||.||.:|.|:::....
 Frog     4 VNDCDELHFALQEAGEKLVLVALSSRRCGHCKLTTPYLESLIPKMPD-VVFLKADVSESQEFMEL 67

  Fly    70 YNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEK 104
            :.|..:|.|.|....|.|..|.|.|::.|...:|:
 Frog    68 FQVKGVPAFHFFYKCNRLYYFQGANTEFLGNKIEE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 30/90 (33%)
LOC100497910XP_031746215.1 TRX_family 8..103 CDD:239245 32/95 (34%)

Return to query results.
Submit another query.