DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and MSL1

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_012274.1 Gene:MSL1 / 854826 SGDID:S000001448 Length:111 Species:Saccharomyces cerevisiae

Alignment Length:81 Identity:31/82 (38%)
Similarity:55/82 (67%) Gaps:1/82 (1%)


  Fly     8 TIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGF 72
            |:|::.|||||..:.|:.:|:.:|:.||::|. |::...|.|||||:..:.|..||.|..::.|.
Yeast    29 TLYVSQLNEKINMQRLRVNLFLLFATFGEVLK-VSMNFKKQRGQAFITMRTIDQASLAQISLNGE 92

  Fly    73 PFYDKPMQIAYSKSDS 88
            .|:.||:::.:|||::
Yeast    93 RFFGKPLKVEFSKSET 108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 31/82 (38%)
RRM_SF 6..96 CDD:302621 31/82 (38%)
RRM2_SNF 137..216 CDD:240923
MSL1NP_012274.1 RRM1_U1A_like 29..105 CDD:240692 29/77 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C14345368
eggNOG 1 0.900 E1_KOG4206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.928771 Normalized mean entropy S1235
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001328
OrthoInspector 1 1.000 T1135735
orthoMCL 1 0.900 OOG5_127059
Panther 1 1.100 LDO PTHR10501
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1270
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.