DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and SNRPB2

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_003083.1 Gene:SNRPB2 / 6629 HGNCID:11155 Length:225 Species:Homo sapiens

Alignment Length:225 Identity:152/226 (67%)
Similarity:183/226 (81%) Gaps:9/226 (4%)


  Fly     1 MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNA 65
            |::.||.||||||:|:||||||||:||||:|||||.::|||||||:||||||||||||:||::||
Human     1 MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNA 65

  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTF-----KERPKKVKPPKPAPGTDEKKDKKKKPS 125
            ||.:||||||.|||:|.|:|:||||::|::|||     |:..||.|..:....|..||..:..|:
Human    66 LRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPN 130

  Fly   126 SAE---NSNPNAQT-EQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFT 186
            ||.   ||.||.|. :.|||.||||.||||||||||||||||||||||||||||.|||||||||.
Human   131 SANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFE 195

  Fly   187 TELQSNAAKEALQGFKITPTHAMKITFAKK 216
            .:.|:.||::|||||||||:||||||:|||
Human   196 NDGQAGAARDALQGFKITPSHAMKITYAKK 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 121/181 (67%)
RRM_SF 6..96 CDD:302621 67/90 (74%)
RRM2_SNF 137..216 CDD:240923 64/79 (81%)
SNRPB2NP_003083.1 RRM1_U2B 6..96 CDD:240922 67/90 (74%)
RRM2_U2B 146..225 CDD:240925 64/79 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C14287783
eggNOG 1 0.900 E1_KOG4206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1608132at2759
OrthoFinder 1 1.000 FOG0001328
OrthoInspector 1 1.000 T608921
orthoMCL 1 0.900 OOG5_127059
Panther 1 1.100 O PTHR10501
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1270
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.