DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and rnpc3

DIOPT Version :10

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001035019.1 Gene:rnpc3 / 565672 ZFINID:ZDB-GENE-060312-35 Length:505 Species:Danio rerio


Alignment Length:123 Identity:30/123 - (24%)
Similarity:56/123 - (45%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PNQTIYINNLNEKIKKEELKKSLYAIFSQFG-----QILDIVALKTLKMRGQAFVIFKEIGSASN 64
            |...:|:.|:.:.:::::| |.:|..:....     .:.|||.:|..:|:||||:......||..
Zfish   403 PTCRLYVKNVAKHVEEKDL-KFIYGRYIDISSEEERNMFDIVLMKEGRMKGQAFIGLPSERSAQK 466

  Fly    65 ALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKK 122
            ||:...|:...|||:.:.:::|             .:||:       ...|.||..:|
Zfish   467 ALKETNGYVLKDKPLVVQFARS-------------AKPKQ-------ESADPKKGGRK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM1_SNF 1..85 CDD:409905 23/84 (27%)
RRM2_SNF 137..216 CDD:240923
rnpc3NP_001035019.1 RRM1_RBM40_like 16..88 CDD:409684
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..236
PABP-1234 <311..>486 CDD:130689 23/83 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..374
RRM2_RBM40_like 404..486 CDD:409685 22/82 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..505 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.