DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and Snrpa

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001040102.1 Gene:Snrpa / 53607 MGIID:1855690 Length:287 Species:Mus musculus

Alignment Length:285 Identity:153/286 (53%)
Similarity:177/286 (62%) Gaps:78/286 (27%)


  Fly     2 EMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNAL 66
            |...|.|||||||||||||:|||||||||||||||||||:..:.:||||||||||||:.||:|||
Mouse    11 ETRANHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRIMKMRGQAFVIFKEVTSATNAL 75

  Fly    67 RTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKK--------------------------- 104
            |:|||||||||||:|.|:|:||||:||:|||:.||.:|                           
Mouse    76 RSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTYVERDRKREKRKPKSQETPAAKKAVQGGAAAPVV 140

  Fly   105 ----------------------------------VKPPKPAPGTDEKKDKKKKPSSA-------E 128
                                              :.||..|||        :.|..|       .
Mouse   141 GAVQPVPGMPPMPQAPRIMHHMPGQPPYMPPPGMIPPPGLAPG--------QIPPGAMPPQQLMP 197

  Fly   129 NSNPNAQ--TEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQS 191
            ...|.||  :|.|||.|||||||||||||:|||||||||||||||||||.|||||||||..|:|:
Mouse   198 GQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQA 262

  Fly   192 NAAKEALQGFKITPTHAMKITFAKK 216
            .||::||||||||..:||||:||||
Mouse   263 GAARDALQGFKITQNNAMKISFAKK 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 123/242 (51%)
RRM_SF 6..96 CDD:302621 72/90 (80%)
RRM2_SNF 137..216 CDD:240923 64/79 (81%)
SnrpaNP_001040102.1 RRM <7..>122 CDD:223796 78/111 (70%)
RRM1_U1A 13..101 CDD:240921 69/88 (78%)
RRM <184..>286 CDD:223796 68/102 (67%)
RRM2_U1A 208..287 CDD:240924 64/79 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4206
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.928771 Normalized mean entropy S1235
OMA 1 1.010
OrthoDB 1 1.010 D1608132at2759
OrthoFinder 1 1.000 FOG0001328
OrthoInspector 1 1.000 T615741
orthoMCL 1 0.900 OOG5_127059
Panther 1 1.100 LDO PTHR10501
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1270
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.