DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and snrpb2

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001011120.1 Gene:snrpb2 / 496533 XenbaseID:XB-GENE-1010457 Length:223 Species:Xenopus tropicalis


Alignment Length:223 Identity:146/223 - (65%)
Similarity:176/223 - (78%) Gaps:7/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNA 65
            |::.||.|:|||||.:|:||.|||:||||:|||||.::|||||||:||||||||||||:.||:||
 Frog     1 MDIRPNHTVYINNLCDKVKKPELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELSSATNA 65

  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENS 130
            ||.:||||||:|||:|.|:|||||::.|:||||.::.||.:..|............|||:.|.|:
 Frog    66 LRQLQGFPFYNKPMRIQYAKSDSDVILKMKGTFADKEKKKEKKKAKAQEQAANAANKKPALASNA 130

  Fly   131 N--PNAQTEQ-----PPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTE 188
            |  |.|...|     |||.||||.||||||||||||||||||||||||||||.|||||||||..|
 Frog   131 NNAPGASQNQQVPDNPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENE 195

  Fly   189 LQSNAAKEALQGFKITPTHAMKITFAKK 216
            .::.||::|||||||||:||||||:|.|
 Frog   196 TEAGAARDALQGFKITPSHAMKITYANK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 116/178 (65%)
RRM_SF 6..96 CDD:302621 64/89 (72%)
RRM2_SNF 137..216 CDD:240923 64/83 (77%)
snrpb2NP_001011120.1 RRM1_U2B 6..96 CDD:240922 64/89 (72%)
RRM_SF 144..223 CDD:388407 63/78 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6359
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 293 1.000 Inparanoid score I2722
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm49059
Panther 1 1.100 - - O PTHR10501
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1270
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.