| Sequence 1: | NP_511045.1 | Gene: | snf / 31442 | FlyBaseID: | FBgn0003449 | Length: | 216 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001011120.1 | Gene: | snrpb2 / 496533 | XenbaseID: | XB-GENE-1010457 | Length: | 223 | Species: | Xenopus tropicalis | 
| Alignment Length: | 223 | Identity: | 146/223 - (65%) | 
|---|---|---|---|
| Similarity: | 176/223 - (78%) | Gaps: | 7/223 - (3%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     1 MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNA 65 
  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENS 130 
  Fly   131 N--PNAQTEQ-----PPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTE 188 
  Fly   189 LQSNAAKEALQGFKITPTHAMKITFAKK 216 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| snf | NP_511045.1 | RRM | <5..177 | CDD:223796 | 116/178 (65%) | 
| RRM_SF | 6..96 | CDD:302621 | 64/89 (72%) | ||
| RRM2_SNF | 137..216 | CDD:240923 | 64/83 (77%) | ||
| snrpb2 | NP_001011120.1 | RRM1_U2B | 6..96 | CDD:240922 | 64/89 (72%) | 
| RRM_SF | 144..223 | CDD:388407 | 63/78 (81%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 108 | 1.000 | Domainoid score | I6359 | 
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 293 | 1.000 | Inparanoid score | I2722 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1608132at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001375 | |
| OrthoInspector | 1 | 1.000 | - | - | otm49059 | |
| Panther | 1 | 1.100 | - | - | O | PTHR10501 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1270 | 
| SonicParanoid | 1 | 1.000 | - | - | X1105 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 8 | 8.190 | |||||