DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and snrpb2

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001011120.1 Gene:snrpb2 / 496533 XenbaseID:XB-GENE-1010457 Length:223 Species:Xenopus tropicalis

Alignment Length:223 Identity:146/224 (65%)
Similarity:176/224 (79%) Gaps:7/224 (3%)


  Fly     1 MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNA 65
            |::.||.|:|||||.:|:||.|||:||||:|||||.::|||||||:||||||||||||:.||:||
 Frog     1 MDIRPNHTVYINNLCDKVKKPELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELSSATNA 65

  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENS 130
            ||.:||||||:|||:|.|:|||||::.|:||||.::.||.:..|............|||:.|.|:
 Frog    66 LRQLQGFPFYNKPMRIQYAKSDSDVILKMKGTFADKEKKKEKKKAKAQEQAANAANKKPALASNA 130

  Fly   131 N--PNAQTEQ-----PPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTE 188
            |  |.|...|     |||.||||.||||||||||||||||||||||||||||.|||||||||..|
 Frog   131 NNAPGASQNQQVPDNPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENE 195

  Fly   189 LQSNAAKEALQGFKITPTHAMKITFAKK 216
            .::.||::|||||||||:||||||:|.|
 Frog   196 TEAGAARDALQGFKITPSHAMKITYANK 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 116/179 (65%)
RRM_SF 6..96 CDD:302621 65/90 (72%)
RRM2_SNF 137..216 CDD:240923 64/84 (76%)
snrpb2NP_001011120.1 RRM <1..>89 CDD:223796 64/88 (73%)
RRM1_U2B 6..96 CDD:240922 65/90 (72%)
RRM <141..>210 CDD:223796 53/69 (77%)
RRM_SF 144..223 CDD:302621 63/79 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C14287500
eggNOG 1 0.900 E1_KOG4206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1608132at2759
OrthoFinder 1 1.000 FOG0001328
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1270
TreeFam 1 0.960
76.740

Return to query results.
Submit another query.