DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and cpo

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001014632.3 Gene:cpo / 45840 FlyBaseID:FBgn0263995 Length:962 Species:Drosophila melanogaster

Alignment Length:139 Identity:36/140 (26%)
Similarity:56/140 (40%) Gaps:36/140 (26%)


  Fly   110 PAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQI-------------------------LFLTNL 149
            ||.......:.....||:.|||.||..|   ||:                         ||::.|
  Fly   388 PATSAVSDSNNNLNSSSSSNSNSNAIME---NQMALAPLGLSQSMDSVNTASNEEEVRTLFVSGL 449

  Fly   150 PEETNEMMLSMLFNQFPGFKEVRL-VPNRH-----DIAFVEFTTELQSNAAKEALQGFKITP--T 206
            |.:.....|.:||..:.|::...| |.:::     .:.||.|.|...:.|||:.|||.:..|  .
  Fly   450 PMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMP 514

  Fly   207 HAMKITFAK 215
            ..:::.|||
  Fly   515 QTIRLEFAK 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 22/93 (24%)
RRM_SF 6..96 CDD:302621
RRM2_SNF 137..216 CDD:240923 27/113 (24%)
cpoNP_001014632.3 RRM <428..>525 CDD:223796 24/97 (25%)
RRM_cpo 441..523 CDD:241128 23/82 (28%)
RRM_scw1_like 712..819 CDD:240691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10501
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.