DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and Snp

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_611632.3 Gene:Snp / 37511 FlyBaseID:FBgn0265192 Length:281 Species:Drosophila melanogaster

Alignment Length:100 Identity:17/100 (17%)
Similarity:34/100 (34%) Gaps:14/100 (14%)


  Fly   101 RPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTNL---------PEETNEM 156
            ||.....|:.:...||..:....|:.::.|..:.:....|...:...:.         |.|..|.
  Fly    22 RPDPNNDPEESFNEDEVTEANSVPAKSKKSRKSKRLAMQPYSYVIAVDFEATCWEKQAPPEWREA 86

  Fly   157 MLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQS 191
            .:.    :||... |.|...:.:..|.::....:|
  Fly    87 EII----EFPAVL-VNLKTGKIEAEFHQYILPFES 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 15/85 (18%)
RRM_SF 6..96 CDD:302621
RRM2_SNF 137..216 CDD:240923 10/64 (16%)
SnpNP_611632.3 ERI-1_3'hExo_like 65..256 CDD:99836 9/57 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4206
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.