DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and msl1

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_595571.1 Gene:msl1 / 2541219 PomBaseID:SPBC8D2.09c Length:111 Species:Schizosaccharomyces pombe

Alignment Length:90 Identity:44/91 (48%)
Similarity:67/91 (74%) Gaps:1/91 (1%)


  Fly     6 NQ-TIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTM 69
            || |:|:||||:||.|.:|:.:||.:||.:|.::|||||||.||||||.|:|.:..:|:.|::.:
pombe     2 NQNTLYVNNLNDKINKNDLRTALYMLFSTYGTVVDIVALKTPKMRGQAHVVFFDPSAAAIAMKAL 66

  Fly    70 QGFPFYDKPMQIAYSKSDSDIVAKI 94
            :.|.|:.|.|:|.|:.|.|.|:.:|
pombe    67 KNFIFFGKEMKIQYAHSKSKIIERI 91

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 44/91 (48%)
RRM_SF 6..96 CDD:302621 44/91 (48%)
RRM2_SNF 137..216 CDD:240923
msl1NP_595571.1 RRM <1..>86 CDD:223796 42/84 (50%)
RRM1_U1A_like 5..82 CDD:240692 38/77 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001328
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127059
Panther 1 1.100 LDO PTHR10501
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1270
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.