DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and usp102

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_596424.1 Gene:usp102 / 2540865 PomBaseID:SPBC4B4.07c Length:249 Species:Schizosaccharomyces pombe

Alignment Length:230 Identity:88/231 (38%)
Similarity:137/231 (59%) Gaps:24/231 (10%)


  Fly     5 PNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTM 69
            |::|:||.|:.|||:...||:.|..:|..:|:::|:.|.|||:|||||||:|..:.:||.||:.:
pombe    24 PSETLYIRNIEEKIRLTMLKRILEHLFGSYGKVIDVQARKTLRMRGQAFVVFDNLENASRALKDL 88

  Fly    70 QGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPK------------------PAPGTDE 116
            ||:|.|.|||.|.||||.|||:.:     :|.|::::..|                  .||....
pombe    89 QGYPLYGKPMMIQYSKSKSDIIVQ-----RESPEEIETRKKDRKNRREMLKRTSALQPAAPKPTH 148

  Fly   117 KKDKKKKPSSAENSNPNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIA 181
            ||...|:...||..:...:...|||::|.|.|:|:|.|..:|:.:|..|.||:|||:||.|..||
pombe   149 KKPVPKRNVGAERKSTINEDLLPPNKVLLLQNIPQEVNADVLTQIFEAFSGFQEVRMVPGRRGIA 213

  Fly   182 FVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK 216
            |||:.::.::..||....|..:: .:.:|:|||:|
pombe   214 FVEYDSDREATVAKNGTTGMSLS-GNQIKVTFARK 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 74/190 (39%)
RRM_SF 6..96 CDD:302621 44/90 (49%)
RRM2_SNF 137..216 CDD:240923 32/79 (41%)
usp102NP_596424.1 RRM <15..217 CDD:223796 80/198 (40%)
RRM1_U1A_like 27..104 CDD:240692 39/77 (51%)
RRM2_U1A_like 172..243 CDD:240693 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H3380
Inparanoid 1 1.050 168 1.000 Inparanoid score I1182
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001328
OrthoInspector 1 1.000 T1124492
orthoMCL 1 0.900 OOG5_127059
Panther 1 1.100 O PTHR10501
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1270
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.