DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and rnp-2

DIOPT Version :8

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_500504.1 Gene:rnp-2 / 177181 WormBaseID:WBGene00004385 Length:206 Species:Caenorhabditis elegans

Alignment Length:216 Identity:108/217 (50%)
Similarity:144/217 (66%) Gaps:13/217 (6%)


  Fly     2 EMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNAL 66
            |:.||.|:||||||||||.:||:|||.|:|.|||:|:.::..:||||||||.|||||:.:||.|.
 Worm     3 EVAPNSTLYINNLNEKIKIDELRKSLVAVFKQFGEIVSVMCFRTLKMRGQAHVIFKELPAASAAR 67

  Fly    67 RTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTF-KERPKKVKPPKPAPGTDEKKDKKKKPSSAENS 130
            ..:.|||||:|||:|.:::.|||:||:.|||: |..||.:         .||..||.|....||.
 Worm    68 EALNGFPFYEKPMRIQFAREDSDVVAQEKGTYIKREPKYL---------SEKILKKPKSRKKENG 123

  Fly   131 NPNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAK 195
            ...   ..|||:|||.||||:.....||.::||||.|.|::|:||||..||||||.|:..:..|:
 Worm   124 GDG---PAPPNKILFCTNLPDSATAEMLEIMFNQFAGLKDIRMVPNRPGIAFVEFDTDSLAIPAR 185

  Fly   196 EALQGFKITPTHAMKITFAKK 216
            ..|..|||:..|.|::.:|||
 Worm   186 TTLNNFKISAEHTMRVDYAKK 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 89/173 (51%)
RRM_SF 6..96 CDD:302621 54/90 (60%)
RRM2_SNF 137..216 CDD:240923 39/79 (49%)
rnp-2NP_500504.1 RRM <6..206 CDD:223796 106/212 (50%)
RRM1_U1A_like 9..86 CDD:240692 47/77 (61%)
RRM2_U1A_like 130..201 CDD:240693 36/71 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C14290661
eggNOG 1 0.900 E1_KOG4206
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H3380
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1608132at2759
OrthoFinder 1 1.000 FOG0001328
OrthoInspector 1 1.000 T375240
orthoMCL 1 0.900 OOG5_127059
Panther 1 1.100 LDO PTHR10501
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1270
TreeFam 1 0.960
1211.750

Return to query results.
Submit another query.