DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cdk7 and CG6800

Sequence 1:NP_511044.1 Gene:Cdk7 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_650984.1 Gene:CG6800 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster

Alignment Length:283 Identity:111/284 (39%)
Similarity:171/284 (60%) Gaps:8/284 (3%)


  Fly    11 RYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENII 75
            ||..|..:|||....|:||.|...|:.||:||:   :.::....|....|||||.||..:.|.|:
  Fly     8 RYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKV---ALKNKFGNIALNTLREIKTLQLCKSEYIL 69

  Fly    76 GLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRDLKP 140
            .::|::..|:.:|||.::....|...:|.....|::..::.:|....||:.|||...::|||:||
  Fly    70 DIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPLSRQQVRKFAHQMFKGIAYLHEAGLMHRDIKP 134

  Fly   141 NNLLVNSDGILKIGDFGLAKSF--GSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCIL 203
            .|||::...:|||.|||||:.:  ...:|:|:..|.|||||:||:|||:::|||||||||.||::
  Fly   135 ANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQKYGTGVDMWAAGCVV 199

  Fly   204 AELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDY--LQFRNFPGTPLDNIFTAAGN 266
            ||::..||...|.:|::||..|..|||:|...:||.|:.|.||  ::|.|..|...||:|.:..:
  Fly   200 AEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFPNSVGIHWDNLFPSCTH 264

  Fly   267 DL-IHLMQRLFAMNPLRRVSCRE 288
            .: |:|:..|...||..|:...|
  Fly   265 AVEINLVSNLVVYNPKNRLKASE 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 111/284 (39%)
STKc_CDK7 11..308 CDD:270833 111/284 (39%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 111/284 (39%)
S_TKc 9..288 CDD:214567 110/283 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109478004
eggNOG 1 0.900 E1_KOG0659
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1367115at2759
OrthoFinder 1 1.000 FOG0001496
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.