DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and Pitslre

DIOPT Version :10

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_061508993.1 Gene:Pitslre / 1269439 VectorBaseID:AGAMI1_007491 Length:955 Species:Anopheles gambiae


Alignment Length:33 Identity:12/33 - (36%)
Similarity:13/33 - (39%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 TLSMELTTTMQMLVPSFTTADPEVPSTSTSTPS 236
            ||..|.||......|......||.|:..|..||
Mosquito   167 TLPYEYTTQPPATWPPVENTTPEQPTVPTPGPS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 STKc_CDK7 11..308 CDD:270833 12/33 (36%)
PitslreXP_061508993.1 None

Return to query results.
Submit another query.