DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fos and kay

Sequence 1:NP_071533.1 Gene:Fos RGDID:2626 Length:380 Species:Rattus norvegicus
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:411 Identity:118/412 (29%)
Similarity:162/412 (39%) Gaps:114/412 (28%)


  Rat     7 NADY-------EASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTV 64
            ||.|       |..::..|||..  ||.||......:.|..|..||             ||...:
  Fly   326 NASYNDTQMNEEQDTTDTSSAHT--DSTSYQAGHIMAGSVNGGGVN-------------NFSNVL 375

  Rat    65 TAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRAQSIGRRGKV 129
            .|:|:|..         .:||..|.....:     ||     ||.|      |||     |..:.
  Fly   376 AAVSSSRG---------SASVGSSNANTSN-----TP-----ARRG------GGR-----RPNRS 410

  Rat   130 EQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLE 194
            ..::||||:||.:||||||.|||:||.||.:.|:.|..|.:|||....:::.||..|...|.:||
  Fly   411 TNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLE 475

  Rat   195 FILAAHRPAC-KIPNDLGFPEEMSVTS---LDLTGGLPEATTPESEEA----------------- 238
            ::||.||..| ||.:|:     :||.:   |....||..|.:..|..:                 
  Fly   476 YLLATHRATCQKIRSDM-----LSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITG 535

  Rat   239 --FTLPLLNDPEPKPSLEPVKNISN--MELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFY 299
              .||...........|:|..||.:  |.:|.||.|..:...||             :|..|   
  Fly   536 MDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSS-------------LDQDG--- 584

  Rat   300 AADWEPLHSSSLGMGPMVT----ELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK 360
                 |..|..:.:.||.|    .|..:.||....:.|..|..:|   |.|  ..|.|.......
  Fly   585 -----PPPSKRITLPPMSTMPHVHLSTILTPTGASSGSLQTPITS---TAP--GGFGSAFPVTSN 639

  Rat   361 GSSSNEPSS--DSLSSPTLLA 379
            |||.|..:|  ::::||||.|
  Fly   640 GSSINNINSIGNNMNSPTLNA 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FosNP_071533.1 Basic motif, required for the activation of phospholipid synthesis, but not for CDS1-binding. {ECO:0000255|PROSITE-ProRule:PRU00978} 139..159 15/20 (75%)
bZIP_Fos 147..200 CDD:269869 23/53 (43%)
coiled coil 147..199 CDD:269869 23/52 (44%)
leucine zipper 165..193 9/28 (32%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/61 (48%)
coiled coil 421..480 CDD:269869 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000603
OrthoInspector 1 1.000 T617766
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.960

Return to query results.
Submit another query.