DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ovo and GFI1B

DIOPT Version :9

Sequence 1:	NP_001162673.1	Gene:	ovo / 31429	FlyBaseID:	FBgn0003028	Length:	1351	Species:	Drosophila melanogaster
Sequence 2:	NP_001358837.1	Gene:	GFI1B / 8328	HGNCID:	4238	Length:	352	Species:	Homo sapiens

Alignment Length:	139	Identity:	46/139 - (33%)
Similarity:	69/139 - (49%)	Gaps:	16/139 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly  1164 SASSNASSHGSAEALCMGSSGGANEDSSSGN-----NKFVCRVCMKTFSLQRLLNRHMKCHSDIK 1223
            :.|....:|..::.:..|||.....|....:     ..|.||:|.|.|.....|:.|:..|||.:
Human   204 AVSLEQHTHVHSQGIPAGSSPEPAPDPPGPHFLRQERSFECRMCGKAFKRSSTLSTHLLIHSDTR 268

  Fly  1224 RYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERR 1288
            .|.|.||||.|:...|:|:||..|||.:|:||.:|.|:|:|..:|.:|.:| |:          .
Human   269 PYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRK-HT----------G 322

  Fly  1289 AKMYVCEEC 1297
            .|.:.||.|
Human   323 FKPFSCELC 331

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ovo	NP_001162673.1	C2H2 Zn finger	1199..1219	CDD:275368	7/19 (37%)
		zf-H2C2_2	1212..1235	CDD:290200	11/22 (50%)
		C2H2 Zn finger	1227..1247	CDD:275368	10/19 (53%)
		zf-H2C2_2	1239..1264	CDD:290200	13/24 (54%)
		C2H2 Zn finger	1255..1276	CDD:275368	8/20 (40%)
GFI1B	NP_001358837.1	C2H2 Zn finger	165..186	CDD:275368
		C2H2 Zn finger	194..214	CDD:275368	2/9 (22%)
		C2H2 Zn finger	244..264	CDD:275368	7/19 (37%)
		COG5048	252..>329	CDD:227381	31/87 (36%)
		C2H2 Zn finger	272..292	CDD:275368	10/19 (53%)
		zf-H2C2_2	284..309	CDD:372612	13/24 (54%)
		C2H2 Zn finger	300..320	CDD:275368	8/20 (40%)
		C2H2 Zn finger	328..345	CDD:275368	3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910