DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ovo and CG2202

DIOPT Version :9

Sequence 1:NP_001162673.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster


Alignment Length:180 Identity:55/180 - (30%)
Similarity:80/180 - (44%) Gaps:40/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1149 QQQQQQQHHQHHSNSSASSNASSHGSAEALC--MGSSGGANE------DSSSGNNKFVCRVCMKT 1205
            ::.|.::|.:.|:           |....||  .|.|...|:      ...:|...:.||.|:|.
  Fly   609 ERAQLREHEKTHT-----------GQRNFLCCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKA 662

  Fly  1206 FSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLES 1270
            |.....|..|.:.|:..|..||..|||.|:..::|..|.|||||.|||||:.|.|||||...|::
  Fly   663 FPRATDLKVHERYHTGTKPNLCNTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDLKA 727

  Fly  1271 HCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKN--NHPFS 1318
            |.:: |:           .:.|.|..|       :.::|.|.|  ||..|
  Fly   728 HIRR-HT-----------GERYKCPHC-------DAYFLQLYNMRNHCMS 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 7/19 (37%)
zf-H2C2_2 1212..1235 CDD:290200 9/22 (41%)
C2H2 Zn finger 1227..1247 CDD:275368 8/19 (42%)
zf-H2C2_2 1239..1264 CDD:290200 16/24 (67%)
C2H2 Zn finger 1255..1276 CDD:275368 9/20 (45%)
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 45/131 (34%)
C2H2 Zn finger 476..496 CDD:275368
zf-H2C2_2 488..513 CDD:290200
C2H2 Zn finger 504..525 CDD:275368
C2H2 Zn finger 532..548 CDD:275368
C2H2 Zn finger 573..593 CDD:275368
C2H2 Zn finger 600..620 CDD:275368 2/10 (20%)
zf-H2C2_2 613..637 CDD:290200 7/34 (21%)
C2H2 Zn finger 628..648 CDD:275368 4/19 (21%)
zf-H2C2_2 640..663 CDD:290200 5/22 (23%)
C2H2 Zn finger 656..676 CDD:275368 7/19 (37%)
C2H2 Zn finger 684..704 CDD:275368 8/19 (42%)
zf-C2H2 684..704 CDD:278523 8/19 (42%)
zf-H2C2_2 696..721 CDD:290200 16/24 (67%)
C2H2 Zn finger 712..732 CDD:275368 9/20 (45%)
C2H2 Zn finger 739..755 CDD:275368 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.