| Sequence 1: | NP_001162673.1 | Gene: | ovo / 31429 | FlyBaseID: | FBgn0003028 | Length: | 1351 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017945235.2 | Gene: | mynn / 101730887 | XenbaseID: | XB-GENE-941010 | Length: | 649 | Species: | Xenopus tropicalis |
| Alignment Length: | 202 | Identity: | 61/202 - (30%) |
|---|---|---|---|
| Similarity: | 83/202 - (41%) | Gaps: | 29/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1131 QNMQQSVQQQSVQQQQSLQQQQQQQHHQHHSNSSASSNASSHGSAEALCMGSSGGANEDSSSGNN 1195
Fly 1196 KFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEK 1260
Fly 1261 SFTQRCSLESHCQKVHSVQHQY------------------AYKERRAKMYVCEECGHTTCEPEVH 1307
Fly 1308 YLHLKNN 1314 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ovo | NP_001162673.1 | C2H2 Zn finger | 1199..1219 | CDD:275368 | 9/19 (47%) |
| zf-H2C2_2 | 1212..1235 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 1227..1247 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 1239..1264 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 1255..1276 | CDD:275368 | 8/20 (40%) | ||
| mynn | XP_017945235.2 | BTB_POZ_ZBTB31_myoneurin | 47..157 | CDD:349526 | |
| zf-C2H2 | 342..363 | CDD:395048 | 10/20 (50%) | ||
| C2H2 Zn finger | 343..363 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 355..380 | CDD:404364 | 11/24 (46%) | ||
| C2H2 Zn finger | 371..391 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 384..408 | CDD:404364 | 14/23 (61%) | ||
| C2H2 Zn finger | 399..419 | CDD:275368 | 8/19 (42%) | ||
| SFP1 | <422..477 | CDD:227516 | 10/55 (18%) | ||
| C2H2 Zn finger | 428..448 | CDD:275368 | 1/19 (5%) | ||
| C2H2 Zn finger | 456..476 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 469..492 | CDD:404364 | 1/8 (13%) | ||
| C2H2 Zn finger | 484..504 | CDD:275368 | |||
| C2H2 Zn finger | 512..532 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||