DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ovo and ovol1

Sequence 1:NP_001162673.1 Gene:ovo FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster
Sequence 2:XP_004913743.1 Gene:ovol1 XenbaseID:XB-GENE-5964939 Length:247 Species:Xenopus tropicalis

Alignment Length:210 Identity:98/211 (46%)
Similarity:124/211 (59%) Gaps:24/211 (11%)


  Fly  1137 VQQQSVQQQQSLQQQQQQQHHQHHSNSSASSNASSHGSAEALCMGSSGGANEDSSSGNNK----- 1196
            :||::..:..:.:......||....::|.|...:.             |..|.:....:|     
 Frog    40 LQQKAEPELDNEEALDLSLHHLRCVSNSPSCQVTE-------------GRQEQAPGTQDKVPMIQ 91

  Fly  1197 ------FVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC 1255
                  |.|.:|.|:||.||:|||||||||::||:.|..||||||||||||||.|||||||||||
 Frog    92 GEQRLLFHCALCEKSFSFQRMLNRHMKCHSEVKRHRCEHCGKGFNDTFDLKRHVRTHTGVRPYKC 156

  Fly  1256 NLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNNHPFSPA 1320
            :||||:||||||||||.:|:|.||..|||||||.|:||||:||.|....|....||::.||.||.
 Frog   157 HLCEKAFTQRCSLESHLKKIHGVQQNYAYKERRTKLYVCEDCGFTADSQESQLHHLQDQHPTSPL 221

  Fly  1321 LLKFYDKRHFKFTNS 1335
            |.:...|......||
 Frog   222 LNRTSKKLAVVLQNS 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ovoNP_001162673.1 C2H2 Zn finger 1199..1219 CDD:275368 14/20 (70%)
zf-H2C2_2 1212..1235 CDD:290200 17/23 (74%)
C2H2 Zn finger 1227..1247 CDD:275368 17/20 (85%)
zf-H2C2_2 1239..1264 CDD:290200 22/25 (88%)
C2H2 Zn finger 1255..1276 CDD:275368 16/21 (76%)
ovol1XP_004913743.1 COG5048 <45..186 CDD:227381 73/154 (47%)
C2H2 Zn finger 100..120 CDD:275368 14/20 (70%)
zf-H2C2_2 112..136 CDD:290200 17/24 (71%)
C2H2 Zn finger 128..148 CDD:275368 17/20 (85%)
zf-H2C2_2 140..165 CDD:290200 22/25 (88%)
C2H2 Zn finger 156..177 CDD:275368 16/21 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3576
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.