DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15472 and boil

DIOPT Version :8

Sequence 1:NP_572184.1 Gene:CG15472 / 31409 FlyBaseID:FBgn0029724 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_572191.2 Gene:boil / 31416 FlyBaseID:FBgn0029730 Length:450 Species:Drosophila melanogaster

Alignment Length:296 Identity:64/297 (22%)
Similarity:109/297 (37%) Gaps:78/297 (26%)


  Fly    19 KQTKLTLNHLCQLPAQCPIEKCISTVFKDDMLQHLAQRHFRSNVKKHLQVAFNGERCTLVFDVSQ 83
            :..|..||||.:.|.:|.:..|...||..:||.|:.::| .::...:|.:.::.:|....|:::.
  Fly    29 RDRKHILNHLSRAPGKCILSNCNQLVFPSNMLVHMLRKH-NNSPNTNLAIIYDNQRLRKTFNLNS 92

  Fly    84 LIGTQTICLGVLLYGGVRGKHSQLPGEREFCYHN-RLKEDSGLESLKDYLPIMVLVKRTTFLCWA 147
            |...:...|.:|||.|..||....|..|...|.| .|....|  ..:.:|.:.:::.:|::.. .
  Fly    93 LKYDEPQVLNILLYAGTEGKPHTRPARRYLSYPNCGLPHSFG--RYEHHLMMNLMICKTSWFS-M 154

  Fly   148 LVDRKMESQEDLNGKQSKDLKQVKHLDFSNDTHPKCSEESIKRCDSGQKNNDLKTTTEAEQEEIM 212
            |.||                                      .|  |:|...:..|.|       
  Fly   155 LPDR--------------------------------------IC--GEKLEKMHGTPE------- 172

  Fly   213 DSDILIIWTQSAPCIRPLHVAMTVFNSTLSVGRSAMRCVAN---SGQMYTEIGGKDLPKD--RHS 272
             :.|.:||.........:...:|.::......||.:|...|   |.|          |||  .|.
  Fly   173 -NTIYVIWLMGPETSSRMFYTLTAYDRYYIQSRSVIRKTRNFFLSQQ----------PKDFLNHE 226

  Fly   273 ---LLITQQELKEICGAE-------HHLHLELILHE 298
               |::..:|..::...|       .::.|||.|||
  Fly   227 NDYLMLRHEEAMDLMNGEGDELNQTSYIKLELFLHE 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15472NP_572184.1 DUF4729 33..284 CDD:292491 51/260 (20%)
boilNP_572191.2 DUF4729 43..249 CDD:292491 52/268 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130854579
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.