DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3009 and OC90

Sequence 1:NP_001162665.1 Gene:CG3009 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001073868.2 Gene:OC90 HGNCID:8100 Length:477 Species:Homo sapiens

Alignment Length:149 Identity:32/150 (21%)
Similarity:46/150 (31%) Gaps:55/150 (37%)


  Fly    49 FCKMHTDRGDIQRMLLQSDPRRIRQVPRESVMELEEVCRRQ-GSYGHEFRGGLGFIYPGTKWCGP 112
            |..:|...||..:::.|..         |.:..|...|..: .|||              .:||.
Human   291 FTFLHLGSGDNMQVMPQLG---------EMLFCLTSRCPEEFESYG--------------CYCGQ 332

  Fly   113 GTAATSYDDLGAHAREDRCCREHDMC-PDVLNVG------------------EC-RRGLCNRGTF 157
            .......|||      ||||..|..| ..|..:|                  :| .:.||.    
Human   333 EGRGEPRDDL------DRCCLSHHCCLEQVRRLGCLLERLPWSPVVCVDHTPKCGGQSLCE---- 387

  Fly   158 TRSHCDCDARFRRCLQAAN 176
             :..|.||.....|:.:|:
Human   388 -KLLCACDQTAAECMTSAS 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 21/96 (22%)
OC90NP_001073868.2 Phospholipase A2-like 1 76..190
otoconin_90 78..195 CDD:153096
Phospholipase A2-like 2 305..361 20/85 (24%)
otoconin_90 307..423 CDD:153096 28/134 (21%)
Phospholipase A2-like 3 373..425 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.