DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3009 and pla2g1b

Sequence 1:NP_001162665.1 Gene:CG3009 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001107095.1 Gene:pla2g1b ZFINID:ZDB-GENE-070117-1 Length:151 Species:Danio rerio

Alignment Length:131 Identity:36/132 (27%)
Similarity:47/132 (36%) Gaps:47/132 (36%)


  Fly   109 WCGPGTAATSYDDLGAHAREDRCCREHDMC-PDVLNVGECRRGLCNRGTFTRSH-CDCDARFRRC 171
            :||.|.:.|..|:|      ||||:.||.| .|.....:|...|.|..|...|. ||..|:.   
Zfish    52 YCGKGGSGTPVDEL------DRCCQVHDQCYSDSWQHDDCWGILDNPYTEIYSFACDKPAKI--- 107

  Fly   172 LQAANTETANTLGAIFYNVVQVTCFQERS-PCSAHQRFEDFYYRTD----HCPAEFRQADLYVPP 231
                                 |:|..::: ||      |.|....|    ||   |.||. |.|.
Zfish   108 ---------------------VSCNADKNRPC------EMFICECDRIAAHC---FAQAG-YNPE 141

  Fly   232 H 232
            :
Zfish   142 Y 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 24/91 (26%)
pla2g1bNP_001107095.1 PLA2c 25..150 CDD:153091 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.