DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3009 and PLA2G5

DIOPT Version :9

Sequence 1:NP_001162665.1 Gene:CG3009 / 31402 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_005245948.1 Gene:PLA2G5 / 5322 HGNCID:9038 Length:169 Species:Homo sapiens


Alignment Length:97 Identity:26/97 - (26%)
Similarity:34/97 - (35%) Gaps:21/97 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 WCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGECR-----------RGL--CNRGTFTRS 160
            :||.|...|..|.      .|.||..||.|...|....|.           .|:  |..|.|...
Human    78 YCGWGGRGTPKDG------TDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHV 136

  Fly   161 H-CDCDARFRRCLQAANTETANTLGAIFYNVV 191
            : |.||.:...||: .|..:.|.....|.|::
Human   137 NLCACDRKLVYCLK-RNLRSYNPQYQYFPNIL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 26/97 (27%)
PLA2G5XP_005245948.1 PLA2c 52..168 CDD:153091 26/97 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.