DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3009 and C07E3.9

Sequence 1:NP_001162665.1 Gene:CG3009 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_496228.1 Gene:C07E3.9 WormBaseID:WBGene00007419 Length:153 Species:Caenorhabditis elegans

Alignment Length:129 Identity:29/130 (22%)
Similarity:37/130 (28%) Gaps:55/130 (42%)


  Fly    75 PR-ESVMELEEVCRRQGSYGHEFRGGLGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMC 138
            || :::..||||...:..|........|.      |||.|.:....|.:      |.||..||.|
 Worm    21 PRLKALWNLEEVAECELHYNALHYNNYGC------WCGIGGSHEPVDGI------DECCMHHDKC 73

  Fly   139 PDVL-------------------------------NVGECRRGLCNRGTFTRSHCDCDARFRRC 171
            .|..                               |:| |:..|          ||||.....|
 Worm    74 YDAAVDNKVCMDVEIEYVDDYSWSCMNSTAICSDKNMG-CKAAL----------CDCDKIVVEC 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 21/102 (21%)
C07E3.9NP_496228.1 PLA2c 25..131 CDD:153091 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.