DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3009 and proca1

Sequence 1:NP_001162665.1 Gene:CG3009 FlyBaseID:FBgn0029720 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_002937670.2 Gene:proca1 XenbaseID:XB-GENE-1005546 Length:581 Species:Xenopus tropicalis

Alignment Length:244 Identity:70/245 (29%)
Similarity:98/245 (40%) Gaps:51/245 (21%)


  Fly    54 TDRGDIQRMLLQSDPRRIR---QVPRESVMELEEVCRRQGSYG------HEFRGG---------- 99
            ||..::......||.|.:.   ....|.|..|...|.|:...|      .||.|.          
 Frog   156 TDGRELVSSTWDSDSRLLSCSVSEDEEEVGSLFSRCSRKSQQGAGAVGLEEFAGAKLACEFSLRA 220

  Fly   100 ------------------LGFIYPGTKWCGPGTAATSYDDLGAHAREDRCCREHDMCPDVLNVGE 146
                              .||.||||.|||.|..|.:::|||.|...|.|||.||.|..|::...
 Frog   221 AESGGQTTPAEPELRRVKRGFTYPGTLWCGAGNNAETFEDLGEHTATDACCRTHDHCAHVIHPFS 285

  Fly   147 CRRGLCNRGTFTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQ--ERSPCSAHQRFE 209
            .|.|..|....|.|||.||.:|:.||:..|...:..:|..||||::|.||:  .:|.|     .|
 Frog   286 YRYGYRNYLWHTISHCQCDTQFKDCLRRVNDTASRVVGQAFYNVIKVPCFEFMYKSQC-----VE 345

  Fly   210 DFYY-----RTDHCPAEFRQADLYVPPHGDNLIAKILAHPQGRALAAPS 253
            .::|     ..:...|..:.:.||  ..|.:||.::....:.....||:
 Frog   346 RYWYGWCKTYNNESVAVPKDSGLY--DFGGDLIDQVSNEKEESPTQAPA 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3009NP_001162665.1 PLA2_bee_venom_like 102..198 CDD:153093 43/98 (44%)
proca1XP_002937670.2 PLA2_bee_venom_like 241..337 CDD:153093 43/96 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.870

Return to query results.
Submit another query.