DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12179 and alms1

DIOPT Version :8

Sequence 1:NP_572175.3 Gene:CG12179 / 31393 FlyBaseID:FBgn0025388 Length:1322 Species:Drosophila melanogaster
Sequence 2:XP_690375.6 Gene:alms1 / 561882 ZFINID:ZDB-GENE-030131-4837 Length:2105 Species:Danio rerio

Alignment Length:1604 Identity:328/1605 (20%)
Similarity:551/1605 (34%) Gaps:518/1605 (32%)


  Fly    44 LDRF------MALSSTASSGASGSTHS-----CALGSVPPPGCASMEHE-------SRPESGHRR 90
            |.||      :.||||.|| :.||.|.     .::|:.  ....|:|.:       |||.|....
Zfish   673 LGRFSDVSSSVNLSSTLSS-SQGSYHGEQSMRASVGAA--SSVVSLEVDNYAPYWTSRPTSPPHT 734

  Fly    91 RTKSSDHRSPDERGEAKEQLRELSVSPPPSKHKISQFT----------SPKSEVT---------- 135
            |..:.:.|.|       ..|..|.:...||. .::.||          ||....|          
Zfish   735 REFNIEDRIP-------LYLLNLGIDQSPST-ILNPFTRRGPIREPEFSPTDLCTIKGSIGTPTK 791

  Fly   136 KTKPNEYTIIPIVLASSPSFRSVAVTQT---------MSQSAED-----IRTPTKSPQMQNKKTQ 186
            .|:|:|...:.....||.|..|...:.:         :||.|.|     |.|...:.|:|:  |.
Zfish   792 STQPSEVDSLQKETFSSSSQHSTESSASVSHHLSVHELSQPATDSSVKVILTQADAAQLQS--TS 854

  Fly   187 TPESVLKSHKRLEWDPSADVGYCKRAMSMSNISTLERSVL---EDCSWRQPTQQ-------RPEA 241
            .|.:.|:         .:|....:|:.|:....:..|.|:   :|......|..       |.|:
Zfish   855 HPSTTLQ---------QSDAAESERSFSLPVPESGPREVVKADDDSLVGSGTLHEIRRLLGRAES 910

  Fly   242 NLDGVQPLLAEEPSPMLDKPTPPLA--------------------CSTFVNRSERTKSLNSGMES 286
            .:.|...|.:...|..|.:....|.                    .|..:.||    |.:|.::.
Zfish   911 LVSGRSSLTSSPGSHRLSESDTSLVSLGRNARGYHTDTSLSAGGNLSLLLTRS----SSDSALKG 971

  Fly   287 SLSSNKGDPR------KKCQRKSRRQDSEVSSCQTDCRSSSQKESTQGSSEAKDIRG--NFTTEG 343
            ||||::|...      |.......|::|..:   .|.|.:.::...:|.|.|...:|  ..||.|
Zfish   972 SLSSSQGPQHIDLTTVKPAALSLSREESLKA---RDLRVTPRRAEPEGCSAADPDKGKPTTTTSG 1033

  Fly   344 TQCSYNRNDTEIDSIMEEEESIDRRKKDDLRISSRVQDPQISSRRPSVS--SSRRESLSSYRRDD 406
            ||.:       :.||   ..|:.:.::|      ..:|..|.|...|:|  |:..||||      
Zfish  1034 TQIN-------LPSI---AVSVPQNEED------TSEDAPIGSSENSLSHVSAEAESLS------ 1076

  Fly   407 SRLNSPNSSRLGSEVSSRVESSRSSSRRESQTNSVYGSLSASSFDYHMHMAQEVEVLKHNQRRQQ 471
               :|.:.|.|.:.|:..::|       ||..:.|  :...|:.|.....|:|..::|.:.||.:
Zfish  1077 ---DSSSESSLAARVAKLLQS-------ESPVSMV--TSRPSTADPEDSRAREWILMKVSGRRCE 1129

  Fly   472 EMEV--EPKKQLEKEQHQNDMQQGEPKGRELKDKNHHS--GREQQEIQPLMRDQRKAEQRHEKDH 532
            .:|:  |.:|::|:.:.:..:.....|.....:.:..|  |.|.|:.:..: ..|..|.|  ...
Zfish  1130 SLELNTEDRKRIEEIKRELLLNTKYTKWSSDSEGSAQSSIGLESQQTKGYV-GLRNMENR--LSD 1191

  Fly   533 QLEREQQG----IQQLSKGQRKAKKRE---KEREQERQYTAAQFEKIRSNRRHVNKENQKPENPV 590
            ||::....    :|.|     :||..|   :|....:.:|:.   .|.:.||     ...|::|.
Zfish  1192 QLQKAPSNPLSTVQDL-----EAKVHEIALREGFSTKPFTSI---TISTTRR-----TPSPQSPP 1243

  Fly   591 VNPSTGVTASTSTTSLDVGSGSR-PGGELDLG---------IDLLCSLVKSRSLSQGQKKKLVRD 645
            .:|.||....|     :|||.:. |.|..|..         ||       .:..::.:::..:.|
Zfish  1244 HSPVTGTLKIT-----NVGSANETPAGTKDSDREKETEGQHID-------EKKTTEDKQENTITD 1296

  Fly   646 IARRISCLE--LTESSTSSRS--------LSSSSKEQLK------------------VPTGS--- 679
            .|:|:|.::  :|.|:.:::|        ||...|.|::                  ||:.:   
Zfish  1297 KAQRMSHIDYNVTSSTFNNKSHLSHIHVTLSPKPKNQIRFEKSTQNISQDVALQRPIVPSVADPQ 1361

  Fly   680 ------------------LQQVAATNTNQSNAR-------SSSKAERIAPPVPAPRKRAAIGSSS 719
                              .::|...||.:.:||       ||:.:.|:.........:.|.|:::
Zfish  1362 LEPMHRISTLNHVSSYEYRERVQGQNTGRVSARFPARHTQSSAPSNRLDMKSRTLSGQTAYGTAA 1426

  Fly   720 PLPESVSYSGSTSGSGEVI----TQKTNIPNRNASTDADIEPLDLQDWLNPMTLSEIEFEERLKG 780
             :|..:.|  ...||.|:.    ......|.|:.:|.....| |..|.:.|      .|.:.:.|
Zfish  1427 -VPTLLPY--KPHGSSELFYMPQVDPELSPGRSDTTVESSHP-DSDDAVPP------HFNKDILG 1481

  Fly   781 GTDSE-------RRRQLHWVKTEINRMQEFKNLLENISLPSKSQKKANTESATAAQI-PSSMRCM 837
            ..:.|       .:..::..:|.:|:          :|......|.|:|..:||.:: ..:|..:
Zfish  1482 SREQEDNTITPKHKEGIYSKRTNMNK----------VSSGDCPPKSASTFVSTAPEVSKKNMETV 1536

  Fly   838 GDQKERPDKE-YLLRQEMSAEAESKEMENSETTTTPPPPVRIESVGVNVTNSDPSTLPAPPPTQP 901
            |...|..||| :.:...|.|: .|.:..:...:||..|.:                     |.:|
Zfish  1537 GIDAEYNDKEDHFVPLNMEAD-NSMDHVHFHNSTTQEPKI---------------------PREP 1579

  Fly   902 PPPPPHLNQRNLQNRKKMATPLLVSGSSTSGGGRSESVCSFVQQRQRQFREHYQNQQQQQFVLLQ 966
            .......|:|..:..||        |...:....|..:.|.:.|..|:|.|.:..::        
Zfish  1580 HYSSSQPNRRPYRGNKK--------GKDRTPHDVSLEITSSLDQLWRRFNEKWSTEE-------- 1628

  Fly   967 QQKLYQLQKQLNQQKDILIQRQQHCGQCAQCGHQRT----CIHQQNCP-------RRQQEAEEQ- 1019
                   .:.:|..:..|:.|.:...:..   |..|    .:.|.:..       .|.||.||| 
Zfish  1629 -------SRSINDGETSLLDRLERLSRLI---HNTTPTDHSVQQSSDSGNGEYDRMRNQEEEEQR 1683

  Fly  1020 -------------------------PDEREQYMQ---------MQYAQAAGSAYATPHQSGSSGA 1050
                                     |.||::.::         .:..|.|..|:....:...|  
Zfish  1684 ERVQLKAPPKHAWVQDEGQGKVHLCPAERDESVETSSSVSTVDTERLQRAFGAHRVAREGMKS-- 1746

  Fly  1051 DKNEAIYYQVVNSQGVASYVQAT---MVSTETQNEASATGGAGGSAI------------------ 1094
            |.:....|..:|::..:....:|   .||..|.|...:|..||..:.                  
Zfish  1747 DGSLLRLYNSINAKKTSRRKPSTKDAAVSVTTDNTDDSTVSAGSLSSSSTSFHHSQRGVYSLKTK 1811

  Fly  1095 --------------------------TRSTTTTTNSSSSMMCISSDMSVPMGMMN-----TCETT 1128
                                      ||...|...|..:...:||......|:.|     |..|.
Zfish  1812 KSKVKLVSKSVQAGDLEIVINGTRKHTRDVGTVFPSPGAFKNVSSSNKFGSGLQNGIPIPTASTA 1876

  Fly  1129 TTTTTHQYDDVACQRVRR------------------GHKETTMNAES------------------ 1157
            ....|....|.:.:.||.                  |.||.....||                  
Zfish  1877 KPIQTALKRDSSNKSVRTRYPHGVSWFVSADELKFDGRKENQPQNESEPSISQAWFEPYSRTRPW 1941

  Fly  1158 --------MQRQTLQVRPRAISYVIQFTPTG-SSEVIEKPP-----SLQDQLQLARPEFCANAKQ 1208
                    .:||..|.:.|...     |.|. .:::.:|..     |||:.|:|.||||.:.:::
Zfish  1942 RESSREPLRERQNQQEQERQTE-----TRTAMETDISDKTSALVRLSLQEALELHRPEFVSRSRE 2001

  Fly  1209 RKAIL------NEMQMIRNARRQELDNVLSQSTSMEALNRHLEQLPPPANTRVRLFTTREMKAIT 1267
            |...|      ..:|.|.|..|:||.|       ..|.:|.|...|.|   |.|:...:||...:
Zfish  2002 RMKRLGLLVEERRLQAIFNREREELFN-------FPAPSRPLRAAPVP---RKRVVPRKEMVQRS 2056

  Fly  1268 SKRCKNLPEVLAAQSRQEEEQRR---RSNRLMRDVFNKRLKSRV 1308
            .::...||||   |.|:|||:||   ||.||...:|||::.:||
Zfish  2057 REKYAKLPEV---QKRREEEKRRAEYRSYRLTAQLFNKKVTNRV 2097

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12179NP_572175.3 ALMS_motif 1190..1309 CDD:291955 47/129 (36%)
alms1XP_690375.6 ALMS_motif 1980..2101 CDD:291955 47/132 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1052275
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.