DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11436 and Ttc17

Sequence 1:NP_572169.1 Gene:CG11436 FlyBaseID:FBgn0029713 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_898929.2 Gene:Ttc17 MGIID:1921819 Length:1198 Species:Mus musculus

Alignment Length:591 Identity:122/592 (21%)
Similarity:219/592 (37%) Gaps:174/592 (29%)


  Fly    11 LLGLFHLIQ-------ACNHWVLREE-QIVPKLDSPFHMREPHNLAAFLKQIRYSEYVERSYLDL 67
            ||.|..|:.       |..|||:.|: :|..::|||.:::.||:|...::|.....|::.....|
Mouse    22 LLSLSALLSVVARGALATTHWVVTEDGKIQQQVDSPMNLKHPHDLVILMRQETTVNYLKELEKQL 86

  Fly    68 LRKREQIVEH------------------LRFSMRFGE-DLAEQAKCAMDYYMLEKRMSYLKITPE 113
            :.::..|.|:                  ::..:..|: ||.:..     |..||.:    .|.||
Mouse    87 VAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVPLGDLDLYDGT-----YITLESK----DIRPE 142

  Fly   114 QLKRINL-----PDQRQLHIQKSASSMGMEPICSDYHRLSVGPATYDHLESFRPEV-LAAAFLER 172
            ..  |:.     ||..|             |.|:....|......:.||...:..| |:|..|.:
Mouse   143 DF--IDTESPVPPDPEQ-------------PDCTKILELPYSIHAFQHLRGVQERVNLSAPLLPK 192

  Fly   173 EHDTNVGMA-----TVELTRRFAVDGLQHHPASWKFHTLSSYYWRMRGNAREALPCARLAALLAP 232
            |......::     :::.......:|||.:.:||..:.|:|:|||::....:.:.||..|...:.
Mouse   193 EDPIFTYLSKRLGRSIDDIGHLIHEGLQKNASSWVLYNLASFYWRIKNEPYQVVECAMRALHFSS 257

  Fly   233 PIFKDIPLLSLGTILFRMGRLADADLILTAAVEHAPNVAENHVVLASALAMKHDFNRSLQHFDEA 297
            ...|||.|::|..:|.|....|||.:::.||::.: :...::..|.:..||..::|.|:..:|.|
Mouse   258 RHNKDIALVNLANVLHRAHFSADAAVVVHAALDDS-DFFTSYYTLGNIYAMLGEYNHSVLCYDHA 321

  Fly   298 ERLDPSTLPRTQQVRNFISCLENLTKKTSKMYSYVKYMQNEVKEFKKL------------KHHIS 350
            .:..|. ..:..:.::.:.|.:.|.:|....:..::...||:||::|.            ||.:.
Mouse   322 LQAKPG-FEQAIKRKHAVLCQQKLEQKLEAQHRSLQRTLNELKEYQKQHDHYLRQQEILEKHKLI 385

  Fly   351 Q---------------------NHE--RLIQQQLPL----------------------------- 363
            |                     ||:  ||:.||..|                             
Mouse   386 QEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHSLHCQWDQPVRYHRGDIFENVDYVQFGDDSS 450

  Fly   364 -GARRLLGLDAKTNNDDL-----------------------HRRGQY--------CS---TRTPN 393
             .:...:..|..||..|:                       :|..|:        |:   .|.|.
Mouse   451 TSSMMSVNFDVPTNQSDVSESVRSSPVAHSVLWVWGRDSDAYRDKQHILWPKRADCTDSYPRVPL 515

  Fly   394 GSDEPVLFCDFYSDMQMRLESKDVDI-DVLERDLKANTDAVIRQVS-TEIRKQFNLEQL-KAAKA 455
            |.:.|..|        :..|:|.:.| ::...|..:..:|.....| |:.||...|..| |..:.
Mouse   516 GGELPTYF--------LPPENKGLRIHELTSDDYSSEEEAQPPDCSITDYRKSHTLSYLVKELEV 572

  Fly   456 QMPAKA 461
            :|..||
Mouse   573 RMDLKA 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11436NP_572169.1 TPR_11 240..302 CDD:290150 16/62 (26%)
TPR repeat 240..265 CDD:276809 9/25 (36%)
TPR repeat 270..300 CDD:276809 7/30 (23%)
Ttc17NP_898929.2 TPR 1 295..328 8/34 (24%)
GBP_C <329..410 CDD:303769 13/81 (16%)
coiled coil 379..390 CDD:293879 3/11 (27%)
coiled coil 399..410 CDD:293879 2/11 (18%)
TPR 2 619..652
TPR repeat 621..647 CDD:276809
TPR repeat 652..684 CDD:276809
TPR_11 658..719 CDD:290150
TPR 3 689..722
TPR 689..718 CDD:197478
TPR repeat 689..717 CDD:276809
TPR 4 1071..1105
TPR repeat 1073..1100 CDD:276809
TPR repeat 1105..1137 CDD:276809
TPR 5 1108..1141
TPR_11 1111..1173 CDD:290150
TPR 6 1142..1175
TPR repeat 1142..1170 CDD:276809
TPR_1 1145..1175 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336043237
eggNOG 1 0.900 E1_KOG4507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005861
OrthoInspector 1 1.000 T1085629
orthoMCL 1 0.900 OOG5_134461
Panther 1 1.100 LDO PTHR16091
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5852
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.