DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11436 and ttc17

Sequence 1:NP_572169.1 Gene:CG11436 FlyBaseID:FBgn0029713 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_698025.7 Gene:ttc17 ZFINID:ZDB-GENE-100422-15 Length:1198 Species:Danio rerio

Alignment Length:433 Identity:99/434 (23%)
Similarity:188/434 (43%) Gaps:78/434 (18%)


  Fly    19 QACNHWVLREE-QIVPKLDSPFHMREPHNLAAFLKQIRYSEYVERSYLDLLRKREQIVEHLRFSM 82
            :|..|||:.|: :|..::|||.:::.||:|..|::|.....|:::....|:.::..|.|:     
Zfish    54 RATTHWVVTEDGKIQQQVDSPLNLKHPHHLVLFMQQETRVNYLKKLEKQLVAQKIHIEEN----- 113

  Fly    83 RFGED---------LAEQAKCA--------MDYY-----MLEKRMSYLKITPEQLKRINLPDQRQ 125
               ||         ..|.|.|.        :|.|     .||.:    .|.|||.  ::|.....
Zfish   114 ---EDRDTGLEQRHYKEDADCVTAKVPLGDLDLYDGTFISLESK----DINPEQF--LDLMSALP 169

  Fly   126 LHIQKSASSMGMEPICSDYHRLSVGPATYDHLESFRPEV-LAAAFLEREHD------TNVGMATV 183
            ..::|        |.|:....|......:.||...:.:| |.:..|.::..      ..:|.:..
Zfish   170 PDLEK--------PDCAKLLDLPYSIHAFQHLRGVQEKVNLTSPLLSKDDPIFTSLCLKLGQSVD 226

  Fly   184 ELTRRFAVDGLQHHPASWKFHTLSSYYWRMRGNAREALPCARLAALLAPPIFKDIPLLSLGTILF 248
            |:..|.. ..|..:.:||..:.|:|:|||::...|.|:.|...|...:|...||:.|:::..:|.
Zfish   227 EVGHRIH-QALLKNSSSWVLYNLASFYWRIKNEPRRAVDCVVRALHFSPRQHKDVALVNMANVLH 290

  Fly   249 RMGRLADADLILTAAVEHAPNVAENHVVLASALAMKHDFNRSLQHFDEAERLDPSTLPRTQQVRN 313
            |....|||.::..||::...::..:|..|.:..||..::|.|:..:::|.:..|. ..:..:.::
Zfish   291 RAHFSADAAILAHAALDLTTDLLTSHYTLGNIYAMLGEYNHSVLCYEQALQAQPG-FEQALRRKH 354

  Fly   314 FISCLENLTKKTSKMYSYVKYMQNEVKEFKKLKHHISQNHE-----RLIQQQLPLGARRL----- 368
            .:.|.:.|.::....:..::...||:||::|...|..:..|     :|||::..|  |.:     
Zfish   355 AVLCQQKLEQRLEAQHRSLQRTLNELKEYQKQHDHYLRQQEMLDKHKLIQEEQIL--RNIIHETQ 417

  Fly   369 LGLDAKTNNDDLHRRGQYCSTRTPNGSDEPVLFCDFYSDMQMR 411
            :..:|:..|..:...||...|          |.|.|  |:.:|
Zfish   418 MAKEAQLGNHQMCHMGQQKFT----------LHCPF--DLPVR 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11436NP_572169.1 TPR_11 240..302 CDD:290150 15/62 (24%)
TPR repeat 240..265 CDD:276809 8/25 (32%)
TPR repeat 270..300 CDD:276809 7/30 (23%)
ttc17XP_698025.7 TPR_1 315..346 CDD:306905 8/32 (25%)
TPR repeat 315..342 CDD:276809 7/27 (26%)
GBP_C <337..428 CDD:328214 18/94 (19%)
TPR repeat 347..374 CDD:276809 2/27 (7%)
coiled coil 397..408 CDD:293879 3/11 (27%)
coiled coil 417..428 CDD:293879 2/11 (18%)
TPR_11 <634..731 CDD:330823
TPR repeat 634..658 CDD:276809
TPR repeat 663..695 CDD:276809
TPR repeat 700..728 CDD:276809
TPR <1036..1175 CDD:223533
TPR repeat 1073..1100 CDD:276809
TPR repeat 1105..1137 CDD:276809
TPR repeat 1142..1170 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336044404
eggNOG 1 0.900 E1_KOG4507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005861
OrthoInspector 1 1.000 T1054752
orthoMCL 1 0.900 OOG5_134461
Panther 1 1.100 LDO PTHR16091
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5852
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.