DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11436 and TTC17

Sequence 1:NP_572169.1 Gene:CG11436 FlyBaseID:FBgn0029713 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_005253073.1 Gene:TTC17 HGNCID:25596 Length:1198 Species:Homo sapiens

Alignment Length:594 Identity:122/595 (21%)
Similarity:221/595 (37%) Gaps:176/595 (30%)


  Fly     6 LAFAVLL-----GLFHLIQACNHWVLREE-QIVPKLDSPFHMREPHNLAAFLKQIRYSEYVERSY 64
            |:.:.||     |.|    |..|||:.|: :|..::|||.:::.||:|...::|.....|::...
Human    23 LSLSALLSVAARGAF----ATTHWVVTEDGKIQQQVDSPMNLKHPHDLVILMRQEATVNYLKELE 83

  Fly    65 LDLLRKREQIVEH------------------LRFSMRFGE-DLAEQAKCAMDYYMLEKRMSYLKI 110
            ..|:.::..|.|:                  ::..:..|: ||.:..     |..||.:    .|
Human    84 KQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVPLGDLDLYDGT-----YITLESK----DI 139

  Fly   111 TPEQLKRINL-----PDQRQLHIQKSASSMGMEPICSDYHRLSVGPATYDHLESFRPEV-LAAAF 169
            :||..  |:.     ||..|             |.|:....|......:.||...:..| |:|..
Human   140 SPEDY--IDTESPVPPDPEQ-------------PDCTKILELPYSIHAFQHLRGVQERVNLSAPL 189

  Fly   170 LEREHDTNVGMA-----TVELTRRFAVDGLQHHPASWKFHTLSSYYWRMRGNAREALPCARLAAL 229
            |.:|......::     :::.......:|||.:.:||..:.::|:|||::....:.:.||..|..
Human   190 LPKEDPIFTYLSKRLGRSIDDIGHLIHEGLQKNTSSWVLYNMASFYWRIKNEPYQVVECAMRALH 254

  Fly   230 LAPPIFKDIPLLSLGTILFRMGRLADADLILTAAVEHAPNVAENHVVLASALAMKHDFNRSLQHF 294
            .:....|||.|::|..:|.|....|||.:::.||::.: :...::..|.:..||..::|.|:..:
Human   255 FSSRHNKDIALVNLANVLHRAHFSADAAVVVHAALDDS-DFFTSYYTLGNIYAMLGEYNHSVLCY 318

  Fly   295 DEAERLDPSTLPRTQQVRNFISCLENLTKKTSKMYSYVKYMQNEVKEFKKL------------KH 347
            |.|.:..|. ..:..:.::.:.|.:.|.:|....:..::...||:||::|.            ||
Human   319 DHALQARPG-FEQAIKRKHAVLCQQKLEQKLEAQHRSLQRTLNELKEYQKQHDHYLRQQEILEKH 382

  Fly   348 HISQ---------------------NHE--RLIQQQLPL-------------------------- 363
            .:.|                     ||:  ||:.||..|                          
Human   383 KLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHSLHCQWDQPVRYHRGDIFENVDYVQFGE 447

  Fly   364 ----GARRLLGLDAKTNNDDL-----------------------HRRGQY--------CS---TR 390
                .:...:..|.::|..|:                       :|..|:        |:   .|
Human   448 DSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHSILWIWGRDSDAYRDKQHILWPKRADCTESYPR 512

  Fly   391 TPNGSDEPVLFCDFYSDMQMRLESKDVDIDVLER-DLKANTDAVIRQVS-TEIRKQFNLEQL-KA 452
            .|.|.:.|..|        :..|:|.:.|..|.. |.....:|.....| |:.||...|..| |.
Human   513 VPVGGELPTYF--------LPPENKGLRIHELSSDDYSTEEEAQTPDCSITDFRKSHTLSYLVKE 569

  Fly   453 AKAQMPAKA 461
            .:.:|..||
Human   570 LEVRMDLKA 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11436NP_572169.1 TPR_11 240..302 CDD:290150 16/62 (26%)
TPR repeat 240..265 CDD:276809 9/25 (36%)
TPR repeat 270..300 CDD:276809 7/30 (23%)
TTC17XP_005253073.1 TPR repeat 294..324 CDD:276809 7/30 (23%)
GBP_C <329..410 CDD:303769 13/81 (16%)
TPR repeat 329..356 CDD:276809 3/27 (11%)
coiled coil 379..390 CDD:293879 3/11 (27%)
coiled coil 399..410 CDD:293879 2/11 (18%)
TPR_12 621..684 CDD:290160
TPR repeat 621..647 CDD:276809
TPR repeat 652..684 CDD:276809
TPR_11 658..718 CDD:290150
TPR 689..718 CDD:197478
TPR repeat 689..717 CDD:276809
TPR repeat 1073..1100 CDD:276809
TPR repeat 1105..1137 CDD:276809
TPR_11 1111..1173 CDD:290150
TPR repeat 1142..1170 CDD:276809
TPR_1 1145..1175 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336045354
eggNOG 1 0.900 E1_KOG4507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005861
OrthoInspector 1 1.000 T1075521
orthoMCL 1 0.900 OOG5_134461
Panther 1 1.100 LDO PTHR16091
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5852
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.