DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11436 and Ttc17

Sequence 1:NP_572169.1 Gene:CG11436 FlyBaseID:FBgn0029713 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001101222.2 Gene:Ttc17 RGDID:1305410 Length:1198 Species:Rattus norvegicus

Alignment Length:575 Identity:116/576 (20%)
Similarity:212/576 (37%) Gaps:167/576 (29%)


  Fly    20 ACNHWVLREE-QIVPKLDSPFHMREPHNLAAFLKQIRYSEYVERSYLDLLRKREQIVEH------ 77
            |..|||:.|: :|..::|||.:::.||:|...::|.....|::.....|:.::..|.|:      
  Rat    38 ATTHWVVTEDGKIQQQVDSPMNLKHPHDLVILMRQETTVNYLKELEKQLVAQKIHIEENEDRDTG 102

  Fly    78 ------------LRFSMRFGE-DLAEQAKCAMDYYMLEKRMSYLKITPEQLKRINL-----PDQR 124
                        ::..:..|: ||.:..     |..||.:    .:.||..  |:.     ||..
  Rat   103 LEQRHNKEDPDCIKAKVPLGDLDLYDGT-----YITLESK----DVRPEDF--IDTESPVPPDPE 156

  Fly   125 QLHIQKSASSMGMEPICSDYHRLSVGPATYDHLESFRPEV-LAAAFLEREHDTNVGMA-----TV 183
            |             |.|:....|......:.||...:..| |:|..|.:|......::     ::
  Rat   157 Q-------------PDCTKILELPYSIHAFQHLRGVQERVNLSAPLLPKEDPIFTYLSKRLGRSI 208

  Fly   184 ELTRRFAVDGLQHHPASWKFHTLSSYYWRMRGNAREALPCARLAALLAPPIFKDIPLLSLGTILF 248
            :.......:|||.:.:||..:.|:|:|||::....:.:.|...|...:....|||.|::|..:|.
  Rat   209 DDIGHLIHEGLQKNSSSWVLYNLASFYWRIKNEPYQVVECTMRALHFSSRHNKDIALVNLANVLH 273

  Fly   249 RMGRLADADLILTAAVEHAPNVAENHVVLASALAMKHDFNRSLQHFDEAERLDPSTLPRTQQVRN 313
            |....|||.:::.||::.:. ...::..|.:..||..::|.|:..:|.|.:..|. ..:..:.::
  Rat   274 RAHFSADAAVVVHAALDDSA-FFTSYYTLGNIYAMLGEYNHSVLCYDHALQAKPG-FEQAIKRKH 336

  Fly   314 FISCLENLTKKTSKMYSYVKYMQNEVKEFKKL------------KHHISQ--------------- 351
            .:.|.:.|.:|....:..::...||:||::|.            ||.:.|               
  Rat   337 AVLCQQKLEQKLEAQHRSLQRTLNELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQMA 401

  Fly   352 ------NHE--RLIQQQLPL------------------------------GARRLLGLDAKTNND 378
                  ||:  ||:.||..|                              .:...:..|..||..
  Rat   402 KEAQLGNHQICRLVNQQHSLHCQWDQPVRYHRGDIFENVDYVQFGDDSSTSSMMSVNFDVPTNQS 466

  Fly   379 DL-----------------------HRRGQY--------CS---TRTPNGSDEPVLFCDFYSDMQ 409
            |:                       :|..|:        |:   .|.|.|.:.|..|        
  Rat   467 DVSESVRSSPVAHSVLWVWGRDSDAYRDKQHILWPKRADCTDSYPRVPLGGELPTYF-------- 523

  Fly   410 MRLESKDVDI-DVLERDLKANTDAVIRQVS-TEIRKQFNLEQL-KAAKAQMPAKA 461
            :..|:|.:.| ::...|..:..:|.....| |:.||...|..| |..:.:|..||
  Rat   524 LPPENKGLRIHELTSDDYSSEEEAQTPDCSITDFRKSHTLSYLVKELEVRMDLKA 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11436NP_572169.1 TPR_11 240..302 CDD:290150 16/62 (26%)
TPR repeat 240..265 CDD:276809 9/25 (36%)
TPR repeat 270..300 CDD:276809 7/30 (23%)
Ttc17NP_001101222.2 TPR 1 295..328 8/34 (24%)
GBP_C <329..410 CDD:303769 13/81 (16%)
coiled coil 379..390 CDD:293879 3/11 (27%)
coiled coil 399..410 CDD:293879 2/11 (18%)
TPR 2 619..652
TPR repeat 621..647 CDD:276809
TPR repeat 652..684 CDD:276809
TPR_11 658..718 CDD:290150
TPR 3 689..722
TPR 689..718 CDD:197478
TPR repeat 689..717 CDD:276809
TPR 4 1071..1105
TPR repeat 1073..1100 CDD:276809
TPR repeat 1105..1137 CDD:276809
TPR 5 1108..1141
TPR_11 1111..1173 CDD:290150
TPR 6 1142..1175
TPR repeat 1142..1170 CDD:276809
TPR_1 1145..1175 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336044626
eggNOG 1 0.900 E1_KOG4507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005861
OrthoInspector 1 1.000 T1089171
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16091
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.