DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11436 and ttc-17

Sequence 1:NP_572169.1 Gene:CG11436 FlyBaseID:FBgn0029713 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_505312.1 Gene:ttc-17 WormBaseID:WBGene00020553 Length:1280 Species:Caenorhabditis elegans

Alignment Length:197 Identity:59/198 (30%)
Similarity:84/198 (42%) Gaps:21/198 (11%)


  Fly   137 MEPICSDYHRLSVGP----------ATYDHLESFRPE-VLAAAF--LEREHDTNVGMAT---VEL 185
            ::|||.:..:....|          |..|....::|| .||.|.  |..|.||...:|.   ..:
 Worm  1081 LQPICPNMDKYKNSPLLGLGHIPAFALSDQFLFYQPEKALAEALKSLGNERDTIEHVAARLHAAM 1145

  Fly   186 TRRFAVDGLQHHPASWKFHTLSSYYWRMRGNAREALPCARLAALLAPPIFKDIPLLSLGTILFRM 250
            ....|.||   | .||....|||.|||:.|||..|:.|.|.|...|||..:|:.|:||..|..:.
 Worm  1146 LHSNAKDG---H-VSWVLCVLSSLYWRVTGNAENAIGCLRCALHTAPPHMRDVALVSLANICHQA 1206

  Fly   251 GRLADADLILTAAVEHAPNVAENHVVLASALAMKHDFNRSLQHFDEAERLDPSTLPRTQQVRNFI 315
            |....|.:...||:..:|.:...|..|.:..|...|:.|:|..:.....|..:..|...::|. |
 Worm  1207 GLFNSALISAGAALSASPRLVAIHFTLGNIYASIGDYQRALNFYYSTLSLQANFQPAKDKIRT-I 1270

  Fly   316 SC 317
            .|
 Worm  1271 YC 1272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11436NP_572169.1 TPR_11 240..302 CDD:290150 16/62 (26%)
TPR repeat 240..265 CDD:276809 8/25 (32%)
TPR repeat 270..300 CDD:276809 6/30 (20%)
ttc-17NP_505312.1 TPR repeat 1156..1185 CDD:276809 15/29 (52%)
TPR repeat 1190..1222 CDD:276809 9/32 (28%)
TPR_11 1195..1256 CDD:290150 15/61 (25%)
TPR repeat 1227..1250 CDD:276809 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336034755
eggNOG 1 0.900 E1_KOG4507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005861
OrthoInspector 1 1.000 T477193
orthoMCL 1 0.900 OOG5_134461
Panther 1 1.100 LDO PTHR16091
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5852
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.